DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and tmprss4b

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001119849.1 Gene:tmprss4b / 327651 ZFINID:ZDB-GENE-030131-5862 Length:432 Species:Danio rerio


Alignment Length:253 Identity:96/253 - (37%)
Similarity:133/253 - (52%) Gaps:47/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||...:|:..|:|||::        :...|:|||:::|...:.|||||:...|      ::.
Zfish   201 RIVGGVETSIEHWPWQVSLQ--------FNHRHMCGGSLLSTSWIISAAHCFTGRT------QEL 251

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE-SPGVRAIP-- 163
            ..:.||.|.:.:......:    |..||.|||||..|.:.|||:|.|.    |. ..|...:|  
Zfish   252 SRWTVVLGQTKVMDVVGVS----VDMIVIHKDYNRLTNDFDIAMLKLT----WPVKTGESILPVC 308

  Fly   164 -----LAIKAPEEGTTCLIHGWGKVTMKEKSA---SLQQAPVPILNKELCQ--VIY--KLPASQM 216
                 ||||     ...::.|||  .:||..|   .||:|.||::|:..|.  .||  .:....:
Zfish   309 LPPHQLAIK-----DMLVVTGWG--LLKEGGALPTVLQKASVPLVNRSECSKPTIYSSSITPRML 366

  Fly   217 CAGFLQGGIDACQGDSGGPLI---CDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            |||||||.:|||||||||||:   ...:|.||:|||||||..|.||||.:|:..|.||
Zfish   367 CAGFLQGNVDACQGDSGGPLVYLSSRWQLIGIVSWGVGCAREGKPGVYADVTQLLDWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 94/251 (37%)
Tryp_SPc 38..273 CDD:238113 96/252 (38%)
tmprss4bNP_001119849.1 SRCR_2 100..179 CDD:292133
SRCR 105..>175 CDD:278931
Tryp_SPc 201..424 CDD:214473 94/251 (37%)
Tryp_SPc 202..427 CDD:238113 96/252 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.