DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG4653

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:120/288 - (41%) Gaps:66/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGL 67
            |..:.||:|....|:.||.            .||..||..       |..:|:||..:       
  Fly     9 HSRLLLLVVIVTLGVVQSS------------RLPAEVGSQ-------PHSISLRRNGV------- 47

  Fly    68 GHVCGGAVISQRVVCSAAHCYAI---NTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLV--QR 127
             ||||||:|.::.:.:||||.::   ..|.|     .:.|.|..||     ..|.|...||  .:
  Fly    48 -HVCGGALIREKWILTAAHCVSLGGGQQSYP-----AKSYNVRVGS-----IQRLTGGQLVPLSK 101

  Fly   128 IVGHKDYNGSTL--ENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSA 190
            |:.|.:|:.|..  .||:|||.|...:...: ....|.||.:.|..|:..:..|||. :..:.|.
  Fly   102 IIIHTNYSSSDAVGSNDLALLELETSVVLNA-NTNPIDLATERPAAGSQIIFSGWGS-SQVDGSL 164

  Fly   191 S--LQQAPVPILNKELCQV-IYKLPASQMC--------AGFLQGGIDACQGDSGGPLICDGRLAG 244
            |  ||.|....|:...||. :|......:|        ||.       |.||:|.|...:.:|.|
  Fly   165 SHVLQVATRQSLSASDCQTELYLQQEDLLCLSPVDEDFAGL-------CSGDAGAPASYNNQLVG 222

  Fly   245 IISWGV-GCADPGYPGVYTNVSHFLKWI 271
            |.::.| ||... .|..|.:|:..|:||
  Fly   223 IAAFFVSGCGSE-QPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 72/252 (29%)
Tryp_SPc 38..273 CDD:238113 74/253 (29%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/255 (29%)
Tryp_SPc 30..249 CDD:214473 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.