DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and prss59.1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:245 Identity:85/245 - (34%)
Similarity:129/245 - (52%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ||||||....:..|:|.|:....         |.|||:::|:..|.||||||.....|.|    .
Zfish    20 KIVGGYECQPNSQPWQASLNSGY---------HFCGGSLVSEYWVVSAAHCYKSRVEVRL----G 71

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLV-QRIVGHKDYNGSTLENDIALLFLNGFIPWESPG-----VR 160
            |..:|:         :..|::::. ::::.:.:|:...|::||.|:.|:      .|.     |:
Zfish    72 EHNIVI---------NEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLS------KPATLNKYVQ 121

  Fly   161 AIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELCQVIY--KLPASQMCAGFL 221
            .:.|......:||.|.:.|||. ||...:.|  ||...:|||:...|...|  .:..:..|||:|
Zfish   122 PVALPNGCAADGTMCRVSGWGN-TMSSTADSNKLQCLEIPILSDRDCNNSYPGMITDTMFCAGYL 185

  Fly   222 QGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            :||.|:||||||||::|:|.|.||:|||.|||:..:||||..|..|.:||
Zfish   186 EGGKDSCQGDSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVCMFSQWI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/243 (34%)
Tryp_SPc 38..273 CDD:238113 84/244 (34%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 83/243 (34%)
Tryp_SPc 21..238 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.