DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG31681

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:291 Identity:102/291 - (35%)
Similarity:135/291 - (46%) Gaps:65/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCLLIVATHSGITQSQIGQPTATASPFVILP--KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            |||.::.:   |..|..|...|...|.   |  :||||..:.|:.||:||||:..|:        
  Fly     1 MCLRLLLS---ILVSIAGLACAARIPG---PEERIVGGSYIPIEYVPWQVSVQNNSL-------- 51

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGH-- 131
            |.|||.:.|.|.:.:||||.:..|...|..|        ||||...:..   |...|.:.:.|  
  Fly    52 HCCGGVIYSDRAILTAAHCLSNVTVTDLSVR--------AGSSYWSKGG---QVLKVLKTIAHPK 105

  Fly   132 ---KDYNGSTLENDIALLFLNGFIPWESP-----GVRAIPLAIKAPEEGTTCLIHGWGKVTMKEK 188
               |.||    ..|||:|.|      |:|     .|:.||||.:.|..||..|..|||..  :|.
  Fly   106 YVPKLYN----PYDIAVLIL------EAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYT--REN 158

  Fly   189 SA----SLQQAPVPILNKELCQVIYK---LPASQMCAGFLQGGIDACQGDSGGPLI--CDG---R 241
            |:    .||...|.|||:..|...||   :....:||...:.  |.||||||||||  ..|   :
  Fly   159 SSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICADGQRW--DTCQGDSGGPLIETTKGGHRQ 221

  Fly   242 LAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            |.|::|||.||..  .||||.:::.|..||:
  Fly   222 LIGMVSWGDGCGT--NPGVYEDIAFFHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 91/255 (36%)
Tryp_SPc 38..273 CDD:238113 93/257 (36%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 91/255 (36%)
Tryp_SPc 29..250 CDD:238113 92/255 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.