DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG31267

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:262 Identity:76/262 - (29%)
Similarity:118/262 - (45%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCY 88
            :.:.||:.|  ..:||||....:...|:.||:      :..|| .|.|.|::|..:.|.:||.|.
  Fly    33 EKSETANKF--SSRIVGGEESDVLAAPYLVSL------QNAYG-NHFCAGSIIHDQWVITAASCL 88

  Fly    89 AINTSVPLVYRDPELYVVVA-----GSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFL 148
            |       ..|...:.||..     ||..        ..|.|:.||.|.:::.....|||||:..
  Fly    89 A-------GLRKNNVQVVTTTYNHWGSEG--------WIYSVEDIVMHCNFDSPMYHNDIALIKT 138

  Fly   149 NGFIPWE--SPGVRAIPLAIKAPEEGTTCLIHGWGKVTM-KEKSASLQQAPVPILNKELCQVIY- 209
            :....::  :..:...||  :...:|.|..::|:|...: .:.|..|||..|..:..|.|...| 
  Fly   139 HALFDYDDVTQNITIAPL--EDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYG 201

  Fly   210 ---KLPASQMCA-GFLQGGIDACQGDSGGPLI-CDGRLAGIISWGVGCADPGYPGVYTNVSHFLK 269
               .|....:|| |  :.|..||.||:|||:: ..|||.|:.:|||.|. .|:|.|:..:|.:..
  Fly   202 GTPDLDVGHLCAVG--KVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCG-YGFPDVFARISFYYS 263

  Fly   270 WI 271
            ||
  Fly   264 WI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/247 (29%)
Tryp_SPc 38..273 CDD:238113 73/248 (29%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 71/247 (29%)
Tryp_SPc 45..268 CDD:238113 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.