DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG32808

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:293 Identity:89/293 - (30%)
Similarity:125/293 - (42%) Gaps:60/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            |||.|.|....:.||.||:||.....      |.||..:::...|.:||||...::        |
  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGR------HSCGATLLNPYWVLTAAHCVRGSS--------P 79

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYN-GSTLENDIALL------FLNGFIPWESPGV 159
            |...:..||..:.|..  :|...|..|..|..|. .....||||||      .|:.|:.      
  Fly    80 EQLDLQYGSQMLARNS--SQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQ------ 136

  Fly   160 RAIPLAIKAPEEGT----TCLIHGWG-KVTMKEKSASLQQAPVPILNKELCQVIYK--LPASQMC 217
               |:.:..|.:.|    :.::.||| ..|.......||:..:.:.:...|...::  |..||:|
  Fly   137 ---PVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQIC 198

  Fly   218 AGFLQGGIDACQGDSGGPLICDG--RLAGIISWGV-GCADPGYPGVYTNVSHFLKWIRRANASLD 279
            ||..:||...|.|||||||:..|  ...||:||.: .||.|.:|||:|.||.::.||.....|  
  Fly   199 AGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS-- 261

  Fly   280 YSEYRQIPPLNLASRRSVSSSCLGIGVLALAMS 312
            ||     ||           |.|.:|.|.:..|
  Fly   262 YS-----PP-----------SSLWVGQLIVGRS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/250 (31%)
Tryp_SPc 38..273 CDD:238113 78/251 (31%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/250 (31%)
Tryp_SPc 30..258 CDD:238113 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.