DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG6067

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_572283.1 Gene:CG6067 / 31529 FlyBaseID:FBgn0029828 Length:307 Species:Drosophila melanogaster


Alignment Length:249 Identity:57/249 - (22%)
Similarity:98/249 - (39%) Gaps:67/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAID 114
            |.|.|:|..::...::|.||:|.||:::..||.:...|  |.:.|...|..|....||.||    
  Fly    62 PHQASIRLLTLERDYFGKGHICSGALVAPSVVLTVTSC--IFSQVKKSYYHPSELRVVLGS---- 120

  Fly   115 RTDRF--TQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCL- 176
             ..||  .::.||   .|....:....:..:|:|.|:..:|...|.::||.|    |..|.|.: 
  Fly   121 -PQRFAPNEQALV---FGVTHIHQPPKDLALAILMLDKDVPENLPYIQAIGL----PTPGATSIL 177

  Fly   177 ---------IHGWG----------KVTMKEKSASLQQAPVPILNKELCQVIYKLPASQMC----- 217
                     |:.||          .||:.....|..|              ::..:.::|     
  Fly   178 DSDHHNLLQINTWGYDGDIRELHDLVTLNATHTSCHQ--------------HQSKSPRICVQPKT 228

  Fly   218 AGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            :.:::|.:   ..|:|..|....||.|:.|         ..|.:.:|:..::||
  Fly   229 SNYIRGRL---YMDAGATLTERDRLLGLRS---------IDGAFEDVASHVEWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 55/247 (22%)
Tryp_SPc 38..273 CDD:238113 57/249 (23%)
CG6067NP_572283.1 Tryp_SPc 62..>174 CDD:304450 36/125 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.