DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG6048

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:286 Identity:100/286 - (34%)
Similarity:150/286 - (52%) Gaps:27/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGI----TQSQIG----QPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSI 60
            |.:.||::...||:    |::.:.    :|...|.|    .:|:.|...::.....||.:|:...
  Fly     8 LAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADP----GRIINGTEASLGATRHQVGIRKALN 68

  Fly    61 HERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDR-----FT 120
            ....:|.||:|||::|....|.:||||:.........:...|.::||.|:  :||.:|     ||
  Fly    69 DGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGN--LDRYNRTNTLTFT 131

  Fly   121 QEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTM 185
            .|   :||:....::.||.:.|||||.|||.:|...|.:|.|.|...|..||..|.:.|||....
  Fly   132 IE---ERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTED 193

  Fly   186 KEKSASLQQAPVPILNKELC----QVIYKLPASQMCAGFLQ-GGIDACQGDSGGPLICDGRLAGI 245
            ...|..|....||::::|.|    .:.:.:....:|||:|: |..|||.|||||||:|...|||:
  Fly   194 GYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGV 258

  Fly   246 ISWGVGCADPGYPGVYTNVSHFLKWI 271
            :|||:.||.|..|||||.||::..||
  Fly   259 VSWGIQCALPRLPGVYTEVSYYYDWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 89/243 (37%)
Tryp_SPc 38..273 CDD:238113 91/244 (37%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 89/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.