DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and LOC312273

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:248 Identity:95/248 - (38%)
Similarity:133/248 - (53%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||||.....||:|||:...|         |:|||::|:.:.|.||||||.....|.|  .:.
  Rat    24 RIVGGYTCQEHSVPYQVSLNAGS---------HICGGSLITDQWVLSAAHCYHPQLQVRL--GEH 77

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG-----VRA 161
            .:|.:......||          ..:::.|.||:..|::|||.|:.|      :||.     |..
  Rat    78 NIYEIEGAEQFID----------AAKMILHPDYDKWTVDNDIMLIKL------KSPATLNSKVST 126

  Fly   162 IPLAIKAPEEGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIY--KLPASQMCAGFLQG 223
            |||....|..||.||:.|||.:....:|.| ||....|:|:..:|...|  ::..:..|.|||:|
  Rat   127 IPLPQYCPTAGTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVCHKAYPRQITNNMFCLGFLEG 191

  Fly   224 GIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANA 276
            |.|:||.|||||::|:|.:.||:|||.|||..|.|||||.|.::|.||.:..|
  Rat   192 GKDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 92/241 (38%)
Tryp_SPc 38..273 CDD:238113 94/242 (39%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 94/243 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.