DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG3795

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:302 Identity:97/302 - (32%)
Similarity:136/302 - (45%) Gaps:46/302 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MC--------LLIVATHSGITQSQIGQPTATASPFVILPK-----IVGGYTV-TIDQVPFQVSVR 56
            ||        |||..:.:..::||.||..:..|.....|.     :.|||.. |.|.|.:.||:|
  Fly     1 MCPSKFVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLR 65

  Fly    57 RRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQ 121
            ... .::.:|..|.|.|.:.|:|.:.:||||...|..    ....:..:||||:.........||
  Fly    66 MGK-PKKFFGDNHFCAGTIFSERAILTAAHCMFSNRR----KLKAKKLMVVAGTPRRLLKSSTTQ 125

  Fly   122 EYLVQRIVGHKDY-NGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTM 185
            ....:.::.|..| .|.:.:.||.|:.|...:.. ...|..|||..|.|..|..|.|.|||.|  
  Fly   126 IIEAEELLPHPKYKKGKSQKYDIGLILLEADLSL-GDAVAKIPLYNKVPVAGAPCSIVGWGTV-- 187

  Fly   186 KEKSASLQQAPVP---------ILNKELCQVIYKL----PASQMCAGFL-QGGIDACQGDSGGPL 236
                  :|..|:|         ||....|:   ||    .|..:||... ...:|:|||||||||
  Fly   188 ------IQFGPLPDEAINGDMQILPDTFCE---KLLGWSNAGMLCANDKHDSDVDSCQGDSGGPL 243

  Fly   237 ICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANASL 278
            |||..:.||:|:|:||.:|...|:||:|.||..||...:..|
  Fly   244 ICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWITENSCPL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/254 (33%)
Tryp_SPc 38..273 CDD:238113 85/250 (34%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 79/237 (33%)
Tryp_SPc 60..278 CDD:214473 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.