DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Tmprss3

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:252 Identity:89/252 - (35%)
Similarity:134/252 - (53%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVY-- 98
            |:||||...::.|.|:|||::.:..        |:|||:||:...:.:||||         ||  
  Rat   215 PRIVGGNVSSLTQWPWQVSLQFQGY--------HLCGGSVITPLWIVTAAHC---------VYDL 262

  Fly    99 RDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIP 163
            ..|:.:.|..|  .:...|.....:||::|:.|..|....|.|||||:.|:..:.::.   ...|
  Rat   263 YHPKSWTVQVG--LVSLMDSPVPSHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDE---TIQP 322

  Fly   164 LAIKAPEE----GTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELC--QVIYK--LPASQMCA 218
            :.:...||    |..|...|||........||  |..|.||:::.::|  :.:|.  :..|.:||
  Rat   323 ICLPNSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCA 387

  Fly   219 GFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            |:|:||:|:|||||||||:|..|    |.|..|:|:|||:...|||||.::.||.||
  Rat   388 GYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 86/249 (35%)
Tryp_SPc 38..273 CDD:238113 88/250 (35%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055
Tryp_SPc 216..444 CDD:214473 86/249 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.