DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:249 Identity:84/249 - (33%)
Similarity:117/249 - (46%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH----VCGGAVISQRVVCSAAHCYAINTSVPLV 97
            ||..|.....:..|:||            ||.|    .|||.::.::.|.:||||..        
  Rat    21 KIYNGVECVKNSQPWQV------------GLFHGKYLRCGGVLVDRKWVLTAAHCSG-------- 65

  Fly    98 YRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGS--TLENDIALLFLNGFIPWESPGVR 160
                 .|:|..|..::.:.|...|..|....:.|..|:|:  ..|:|:.||.||..|.. :..||
  Rat    66 -----KYMVRLGEHSLSKLDLTEQLRLTTFSITHPSYHGAYQNHEHDLRLLRLNRPISL-TYAVR 124

  Fly   161 AIPLAIKAPEEGTTCLIHGWGKVTMKEKSA---SLQQAPVPILNKELCQVIY--KLPASQMCAGF 220
            .:.|.......|..|.|.||| .|.|....   .||...:.|::.|.|:.::  ::..:.:|||.
  Rat   125 PVALPSSCAPTGAKCHISGWG-TTNKPWDPFPDRLQCLDLSIVSNETCRAVFPGRVTENMLCAGG 188

  Fly   221 LQGGIDACQGDSGGPLICDGRLAGIISWG-VG-CADPGYPGVYTNVSHFLKWIR 272
             :.|.|||||||||||:|.|.|.|::||| || |...|.|||||.|..:..|||
  Rat   189 -EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 81/246 (33%)
Tryp_SPc 38..273 CDD:238113 83/248 (33%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.