DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and F12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001014028.1 Gene:F12 / 306761 RGDID:1359175 Length:603 Species:Rattus norvegicus


Alignment Length:263 Identity:88/263 - (33%)
Similarity:125/263 - (47%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYR 99
            |.::|||........|:..::         |.....|.|::|....|.:||||.....:      
  Rat   359 LRRVVGGLVALPGSHPYIAAL---------YWGDSFCAGSLIDPCWVLTAAHCLQKRPA------ 408

  Fly   100 DPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNG---FIPWESPGVR- 160
             ||...||.|....:::....|...|.....|:.::..|.::|:|||.|.|   .....||.|: 
  Rat   409 -PEELTVVLGQDRHNQSCERCQTLAVHSYRLHEGFSSKTYQHDLALLRLRGRKNSCAILSPHVQP 472

  Fly   161 -AIPLAIKAPEEGTTCLIHGWGK--VTMKEKSASLQQAPVPILNKELC-------QVIYKLPASQ 215
             .:|.:...|.|...|.:.|||.  ...:|.:..||:|.||.::.:.|       ..|  || ..
  Rat   473 VCLPSSAAPPSETVLCEVAGWGHQFEGAEEYATFLQEAQVPFISLDRCSSSNVHGDAI--LP-GM 534

  Fly   216 MCAGFLQGGIDACQGDSGGPLICDG-------RLAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            :|||||:||.|||||||||||:||.       .|.|:||||.||.|...|||||:|:::|.||:.
  Rat   535 LCAGFLEGGADACQGDSGGPLVCDEGVTERQLTLRGVISWGSGCGDRNKPGVYTDVANYLDWIQE 599

  Fly   274 ANA 276
            ..|
  Rat   600 HTA 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/254 (33%)
Tryp_SPc 38..273 CDD:238113 86/255 (34%)
F12NP_001014028.1 FN2 40..87 CDD:238019
EGF_CA 95..130 CDD:238011
FN1 132..170 CDD:238018
EGF 177..207 CDD:278437
Kringle 216..294 CDD:278480
Tryp_SPc 361..597 CDD:214473 84/254 (33%)
Tryp_SPc 362..600 CDD:238113 86/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.