DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and HABP2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:252 Identity:90/252 - (35%)
Similarity:123/252 - (48%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYR 99
            :.:|.||:..|..:.|:|.|::...........||.||||:|....|.:||||..|.|       
Human   311 IKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAHCTDIKT------- 368

  Fly   100 DPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYN--GSTLENDIALLFL---NGFIPWESPGV 159
              ....||.|...:.:.:...|.:.|::|..:..||  .....||||||.|   :|....||..|
Human   369 --RHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPVDGHCALESKYV 431

  Fly   160 RAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELC--QVIY--KLPASQMCAGF 220
            :.:.|...:...|:.|.|.|||.....:.|..|..|.|.::...||  :.:|  .:..|.:|||.
Human   432 KTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDDSMICAGN 496

  Fly   221 LQ-GGIDACQGDSGGPLIC--DGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            || .|.|.|||||||||.|  ||.  :.||:|||:.|..  .|||||.|:.||.||:
Human   497 LQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGK--RPGVYTQVTKFLNWIK 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/247 (36%)
Tryp_SPc 38..273 CDD:238113 90/249 (36%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 90/249 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.