DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss42

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:324 Identity:99/324 - (30%)
Similarity:142/324 - (43%) Gaps:90/324 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WMCLLIVATH---SGITQSQ---------------IGQPTATASPFV--------ILPKIVGGYT 43
            |....|::|.   ||:::|.               ..|.:.|..||.        .|.||:||..
  Rat    25 WAAASILSTSGFPSGLSESPGENSPPPTPVHTSKVASQGSTTRFPFTNFSIVCGQPLMKIMGGVD 89

  Fly    44 VTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC------YAINTSVPLVYRDPE 102
            ....:.|:|||:|.|.:        |||||::::.:.|.:||||      |.:......|||...
  Rat    90 AEEGKWPWQVSLRVRHM--------HVCGGSLLNSQWVLTAAHCIHSRVQYNVKMGDRSVYRQNT 146

  Fly   103 LYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGST-LENDIALLFLNGFIPWES---PGVRAIP 163
            ..|:.                 :|.|..|..::.:| ::||||||.|...:.:.|   |  ..:|
  Rat   147 SLVIP-----------------IQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHP--ICVP 192

  Fly   164 LAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNK--------ELCQVIYKLPAS------ 214
            ......:.||.|.:.||||     ......|.|..||.:        |.|..:.|..||      
  Rat   193 TGTFHVKAGTKCWVTGWGK-----PDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLV 252

  Fly   215 ---QMCAGFLQGGIDACQGDSGGPLIC--DGRLA--GIISWGVGCADPGYPGVYTNVSHFLKWI 271
               .:|| :.:||.|||||||||||.|  |.|..  |::|||:||...|:|||||:|:.:.||:
  Rat   253 KRGMVCA-YKEGGKDACQGDSGGPLSCEFDNRWVQIGVVSWGIGCGRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 87/264 (33%)
Tryp_SPc 38..273 CDD:238113 87/265 (33%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 86/263 (33%)
Tryp_SPc 84..315 CDD:238113 86/263 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.