DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and GZMH

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:268 Identity:81/268 - (30%)
Similarity:124/268 - (46%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QPTATASPFVILP-----KIVGGYTVTIDQVPFQVSV-------RRRSIHERHYGLGHVCGGAVI 76
            ||......|::.|     :|:||:.......|:...|       |:|            |||.::
Human     2 QPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKR------------CGGILV 54

  Fly    77 SQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYL-VQRIVGHKDYNGSTLE 140
            .:..|.:||||...:.:|.|            |:..|...:| ||::: |:|.:.|..||.....
Human    55 RKDFVLTAAHCQGSSINVTL------------GAHNIKEQER-TQQFIPVKRPIPHPAYNPKNFS 106

  Fly   141 NDIALLFLNGFIPWESPGVRAIPL-AIKAP-EEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKE 203
            |||.||.|.....| :..||.:.| :.||. :.|..|.:.|||.|:|...:.:||:..:.:....
Human   107 NDIMLLQLERKAKW-TTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDC 170

  Fly   204 LCQVIYK---LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVS 265
            .|:.::.   ..|:::|.|..:......:|||||||:|.....||:|:|.....|  ||||..||
Human   171 QCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTP--PGVYIKVS 233

  Fly   266 HFLKWIRR 273
            |||.||:|
Human   234 HFLPWIKR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/246 (30%)
Tryp_SPc 38..273 CDD:238113 76/247 (31%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 77/249 (31%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.