DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk1c3

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:286 Identity:98/286 - (34%)
Similarity:137/286 - (47%) Gaps:55/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSG-ITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGL 67
            :|..:|.:|...| |..:..||           .::|||:....:..|:||:|    |:|     
  Rat     1 MWFLILFLALSLGQIDAAPPGQ-----------SRVVGGFKCEKNSQPWQVAV----INE----- 45

  Fly    68 GHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHK 132
             .:|||.:|....|.:|||||:.|            |.|:.|.:.:...   .|..||.:...|.
  Rat    46 -DLCGGVLIDPSWVITAAHCYSDN------------YHVLLGQNNLSED---VQHRLVSQSFRHP 94

  Fly   133 DYNGSTL----------ENDIALLFLNGFIPWE-SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMK 186
            ||....:          .||:.||.|:.  |.: :.||:.|.|..|.|:.|:|||:.|||.....
  Rat    95 DYKPFLMRNHTRKPKDYSNDLMLLHLSE--PADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPS 157

  Fly   187 EKS--ASLQQAPVPILNKELCQVIYKLPAS--QMCAGFLQGGIDACQGDSGGPLICDGRLAGIIS 247
            |..  ..||...:.:|:.|.|...||...:  .:|||.|:||.|.|:|||||||||||.|.||.|
  Rat   158 EWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITS 222

  Fly   248 WG-VGCADPGYPGVYTNVSHFLKWIR 272
            || |.|.:|..||:||.:..|..||:
  Rat   223 WGSVPCGEPNKPGIYTKLIKFTSWIK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 89/249 (36%)
Tryp_SPc 38..273 CDD:238113 91/251 (36%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 89/249 (36%)
Tryp_SPc 25..250 CDD:238113 91/251 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.