DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk1c8

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:290 Identity:95/290 - (32%)
Similarity:139/290 - (47%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILP---KIVGGYTVTIDQVPFQVSVRRRSIHERHY 65
            :|:.:|.:....|...         |:|    |   :|:||:....:..|:||:|       .|:
  Rat     1 MWLLILFLILSLGWND---------AAP----PGQSRIIGGFNCEKNSQPWQVAV-------YHF 45

  Fly    66 GLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVG 130
            .... |||.:|....|.:|||||::|            |.|..|.:.:...:.|.|..||.:...
  Rat    46 NEPQ-CGGVLIHPSWVITAAHCYSVN------------YQVWLGRNNLLEDEPFAQHRLVSQSFP 97

  Fly   131 HKDYN-----------GSTLENDIALLFLNGFIPWE-SPGVRAIPLAIKAPEEGTTCLIHGWGKV 183
            |..:|           |:...||:.||.|.  .|.: :.||:.|.|..:.|:.|:|||..|||.:
  Rat    98 HPGFNLDIIKNHTRKPGNDYSNDLMLLHLK--TPADITDGVKVIDLPTEEPKVGSTCLTSGWGSI 160

  Fly   184 T-MK-EKSASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAG 244
            | :| |....||...:.:|:.|.|...|  ::....:|||.:.||.|.|:|||||||||||.|.|
  Rat   161 TPLKWEFPDDLQCVNIHLLSNEKCIKAYNDEVTDVMLCAGEMDGGKDICKGDSGGPLICDGVLQG 225

  Fly   245 IISWG-VGCADPGYPGVYTNVSHFLKWIRR 273
            |.||| :.|.:|..|.|||.:..|..||::
  Rat   226 ITSWGSMPCGEPNKPSVYTKLIKFTSWIKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 87/250 (35%)
Tryp_SPc 38..273 CDD:238113 89/251 (35%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 87/250 (35%)
Tryp_SPc 25..256 CDD:238113 89/253 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.