DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk9

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:247 Identity:82/247 - (33%)
Similarity:120/247 - (48%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :.||......:..|:|..:        .|....:||..:|:.:.:.:||||           |.|
  Rat    22 RAVGARECQRNSQPWQAGL--------FYLTRQLCGATLINDQWLLTAAHC-----------RKP 67

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLEN----DIALLFLNGFIPWE---SPGV 159
            .|:|.: |...:.:.:...:..||.....|..:|.....|    ||.|:.|    |.:   ||.|
  Rat    68 YLWVRL-GEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRL----PRKVRLSPAV 127

  Fly   160 RAIPLAIKAPEEGTTCLIHGWGKVTMK--EKSASLQQAPVPILNKELCQVIY--KLPASQMCAGF 220
            :.:.|:...|..||.|||.|||.|:..  :...:||.|.:.||:.:||:..|  .:....:|||.
  Rat   128 QPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCRWAYPGHISEKMLCAGL 192

  Fly   221 LQGGIDACQGDSGGPLICDGRLAGIISWG-VGCADPGYPGVYTNVSHFLKWI 271
            .:||..:|||||||||:|.|.||||:|.| ..|:.|..|.|||:|.|:|.||
  Rat   193 WEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/245 (33%)
Tryp_SPc 38..273 CDD:238113 82/246 (33%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 82/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.