DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk10

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:268 Identity:74/268 - (27%)
Similarity:125/268 - (46%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ASPFVILP--------KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAA 85
            |:..::||        :..|....::.| |:|||:        .:.|...|.|.::.|..|.:||
  Rat    31 AAQALLLPGNTTREDLEAFGTLCPSVSQ-PWQVSL--------FHNLQFQCAGVLVDQNWVLTAA 86

  Fly    86 HCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDY---NGSTL-----END 142
            ||:   .:.||..|..:.::::..|..:..|:         ..|.|..|   :|..|     |:|
  Rat    87 HCW---RNKPLRARVGDDHLLLFQSEQLRSTN---------SPVFHPKYQPCSGPVLPLRSDEHD 139

  Fly   143 IALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMK--EKSASLQQAPVPILNKELC 205
            :.:|.|:..:...|. |..:.|..:..:....|.:.|||....:  :.:.||..:.|.:|:::.|
  Rat   140 LMMLKLSSPVVLTSK-VHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRSLSCSRVTLLSQKQC 203

  Fly   206 QVIYK--LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGV---GCADPGYPGVYTNVS 265
            :..|.  :..:.:||| :....|:||.||||||:||..|.||:||.:   |.|.. ||.||..:.
  Rat   204 ETFYPGVITNNMICAG-MDRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAATQ-YPAVYAKIC 266

  Fly   266 HFLKWIRR 273
            ::..||||
  Rat   267 NYTNWIRR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 67/248 (27%)
Tryp_SPc 38..273 CDD:238113 69/249 (28%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.