DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk11

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:278 Identity:85/278 - (30%)
Similarity:131/278 - (47%) Gaps:51/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH 69
            ::.|.:|..|.|      |:           .:|:.||.......|:||::.:::        ..
  Rat    35 FIALALVTGHVG------GE-----------TRIIKGYECRPHSQPWQVALFQKT--------RL 74

  Fly    70 VCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDY 134
            :||..:|:.:.:.:||||           |.|. ||::.|...:::||...|..:......|..:
  Rat    75 LCGATLIAPKWLLTAAHC-----------RKPH-YVILLGEHNLEKTDGCEQRRMATESFPHPGF 127

  Fly   135 NGS----TLENDIALLFLN--GFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSA--S 191
            |.|    ...|||.|:.::  .||   :..||.:.|:......||:|||.|||..:..:...  |
  Rat   128 NNSLPNKDHRNDIMLVKMSSPAFI---TRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHS 189

  Fly   192 LQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVG-CA 253
            |:.|.|.|:..:.|:..|  .:..:.:||...:.|.|:|||||||||:|:|.|.||||||.. ||
  Rat   190 LRCANVSIIGHKECERAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCA 254

  Fly   254 DPGYPGVYTNVSHFLKWI 271
            ....|||||.|..:..||
  Rat   255 VTRKPGVYTKVCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 78/244 (32%)
Tryp_SPc 38..273 CDD:238113 80/245 (33%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 78/244 (32%)
Tryp_SPc 51..275 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.