DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk13

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:288 Identity:100/288 - (34%)
Similarity:142/288 - (49%) Gaps:47/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LW-----MCLLIVATHSGITQS--QIGQPTATASPFVILPKIVGGYTVTIDQVPFQVS--VRRRS 59
            :|     :..|.:|...||::.  :|...|...|.|  ||   ||||......|:|.:  ||.|.
  Rat     1 MWPLVATIACLTLALSGGISRDYPKILNGTNGTSGF--LP---GGYTCLPHSQPWQAALLVRGRL 60

  Fly    60 IHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYL 124
            :          |||.::..:.|.:||||            ..:.|.|..|..|:.|.:...|...
  Rat    61 L----------CGGVLVHPKWVLTAAHC------------RKDGYTVHLGKHALGRVENGEQAME 103

  Fly   125 VQRIVGHKDYNGSTL----ENDIALLFLNGFIPWESPGVRAIPL-AIKAPEEGTTCLIHGWGKVT 184
            |.|.:.|.:|..|..    ::||.||.|...:.. |..||.:.| |......||.|.:.|||..|
  Rat   104 VVRSIPHPEYQVSPTHLNHDHDIMLLELKSPVQL-SNHVRTLQLSADDCLPTGTCCRVSGWGTTT 167

  Fly   185 MKEKS--ASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGI 245
            ..:.:  .:||.|.:.:.:.|.|:.:|  |:.|:.:|||..:||.|:|:|||||||||:|:|.||
  Rat   168 SPQVNYPKTLQCANIELRSDEECRQVYPGKITANMLCAGTKEGGKDSCEGDSGGPLICNGKLYGI 232

  Fly   246 ISWG-VGCADPGYPGVYTNVSHFLKWIR 272
            |||| ..|..|..|||||.||.:|:||:
  Rat   233 ISWGDFPCGQPNRPGVYTRVSKYLRWIQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 87/245 (36%)
Tryp_SPc 38..273 CDD:238113 89/247 (36%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 89/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.