DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Gzmm

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:288 Identity:90/288 - (31%)
Similarity:128/288 - (44%) Gaps:50/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHLWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHY 65
            |:..|..||::|..   |...:|.....        :|:||........|:.||::...      
  Rat     1 MEVRWSLLLLLALK---TLWAVGNRFEA--------QIIGGREAVPHSRPYMVSLQNTK------ 48

  Fly    66 GLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVG 130
              .|||||.::.|:.|.:||||    .|.||    .:|.:|....|..|..|.....|:.|.| .
  Rat    49 --SHVCGGVLVHQKWVLTAAHC----LSEPL----QQLKLVFGLHSLHDPQDPGLTFYIKQAI-K 102

  Fly   131 HKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI-----KAPEEGTTCLIHGWGKVTMKEKSA 190
            |..|| ...|||:|||.|:|.:   .|.....|||:     ..|.||:.|...|||....:.:.|
  Rat   103 HPGYN-LKYENDLALLKLDGRV---KPSKNVKPLALPRKPRDKPAEGSRCSTAGWGITHQRGQLA 163

  Fly   191 -SLQQAPVPILNKELCQ-------VIYKLPASQMCAGFLQGGIDACQGDSGGPLIC-DGRLAGII 246
             |||:..:.:|:..:|.       |   |..|.:|......|...|:|||||||:| .|::.||:
  Rat   164 KSLQELDLRLLDTRMCNNSRFWNGV---LTDSMLCLKAGAKGQAPCKGDSGGPLVCGKGKVDGIL 225

  Fly   247 SW-GVGCADPGYPGVYTNVSHFLKWIRR 273
            |: ...|.|...|.|.|.|:.:..|||:
  Rat   226 SFSSKNCTDIFKPTVATAVAPYSSWIRK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/248 (32%)
Tryp_SPc 38..273 CDD:238113 82/249 (33%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 83/251 (33%)
Trypsin 27..251 CDD:278516 80/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.