DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss38

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:321 Identity:95/321 - (29%)
Similarity:157/321 - (48%) Gaps:49/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLWMCLLIVATHSGI---TQSQIGQPTATASPFVILPKIVGGYTVTIDQV-PFQVSVRRRSIHER 63
            |.|..||.......:   ..|..|||       .:..|::|| .:|||:. |:|||:        
  Rat    83 HPWPPLLWCGREPSLHLFLSSACGQP-------ALHGKLLGG-ELTIDRKWPWQVSI-------- 131

  Fly    64 HYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPEL--YVVVAGSSAIDRTDRFTQEYLVQ 126
            ||...|||||::::...|.:||||:|         |:..|  :.:..|.:.::..::.||.:.:.
  Rat   132 HYAGFHVCGGSILNAYWVLTAAHCFA---------REKRLQTFDMYVGITNLEVANKHTQWFEIN 187

  Fly   127 RIVGHKDYN-GSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPE---EGTTCLIHGWGKVTMK- 186
            :::.|..:. ...:..|:||:.....|.:..   ..:|:.:.:..   ...:|...|||.|:.: 
  Rat   188 QVIIHPTFEMFHPVGGDVALVQSKSAIVFSD---YVLPICLPSSNLNLSDLSCWTTGWGMVSPQG 249

  Fly   187 EKSASLQQAPVPILNKELCQVIYKLPA----SQMCAGFLQGGIDACQGDSGGPLICDGRLA---- 243
            |....|.:|.:|::.|..||::|.|.:    ..:|||.::...:.|:||||.||:|.....    
  Rat   250 ETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQI 314

  Fly   244 GIISWGVGCADPGYPGVYTNVSHFLKWIRRANASLDYSEYRQIPPLNLASRRSVSSSCLGI 304
            ||:|||.|||.|.||||:.|||:||.|||....::  .:..|:.|...:|.|:..||.:.|
  Rat   315 GIVSWGRGCAQPLYPGVFANVSYFLNWIRYNMETI--PDPPQLTPFVSSSLRATVSSFVTI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/249 (31%)
Tryp_SPc 38..273 CDD:238113 78/250 (31%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 77/247 (31%)
Tryp_SPc 116..342 CDD:214473 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.