DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss34

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:267 Identity:80/267 - (29%)
Similarity:122/267 - (45%) Gaps:57/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGL-----GHVCGGAVISQRVVCSAAHCYAINTSVPLV 97
            ||||..|:..:.|:|||:       |.|.:     .|:|||::|..:.|.:||||      |.|.
  Rat    33 IVGGCPVSASRFPWQVSL-------RFYNMKLSKWEHICGGSLIHPQWVLTAAHC------VELK 84

  Fly    98 YRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYN------GSTLENDIALLFLNGFIPWES 156
            ..:...:.|..|...:...|:..:   |.:|:.|..::      |..   |||||.|:..:....
  Rat    85 EMEASCFRVQVGQLRLYENDQLMK---VAKIIRHPKFSEKLSAPGGA---DIALLKLDSTVVLSE 143

  Fly   157 PGVRAIPLAIKAPEE----GTTCLIHGWGKVTMKE---KSASLQQAPVPILNKELCQVIYKLPAS 214
               |..|:::.|..:    ..|..:.|||.:....   ....|::..|||:....|:..|:..:|
  Rat   144 ---RVHPVSLPAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSS 205

  Fly   215 -----------QMCAGFLQGGIDACQGDSGGPLICDGRLA----GIISWGVGCADPGYPGVYTNV 264
                       .:|||  ..|.|:||.||||||:|....:    |::|||:||..|.:|||||.|
  Rat   206 LDRTTKIIKDDMLCAG--MEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRV 268

  Fly   265 SHFLKWI 271
            ..:|.||
  Rat   269 MSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 78/265 (29%)
Tryp_SPc 38..273 CDD:238113 80/267 (30%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 80/267 (30%)
Tryp_SPc 33..275 CDD:214473 78/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.