DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss29

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:289 Identity:92/289 - (31%)
Similarity:138/289 - (47%) Gaps:56/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GITQSQIGQPTA---TASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG-HVCGGAVI 76
            |:|...:|...|   .:.|..:|..||||.:....:.|:|||:|   ::..::... |:|||::|
  Rat     6 GLTLIFLGSSIAGIPASVPEDVLVGIVGGNSAPQGKWPWQVSLR---VYRYNWASWVHICGGSII 67

  Fly    77 SQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYL--------VQRIVGHKD 133
            ..:.|.:||||...:.:      ||..:.:..|           |.||        |.|::.|.|
  Rat    68 HPQWVLTAAHCIHESDA------DPSAFRIYLG-----------QVYLYGGEKLLKVSRVIIHPD 115

  Fly   134 YNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPE--EGTTCLIHGWGKVTMKEK---SASLQ 193
            :..|.|.:|:|||.|...:. ..|.|:.:.|:..:.|  :...|.:.|||.|:|.|.   ...||
  Rat   116 FVRSGLGSDVALLQLAQSVR-SFPNVKPVKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQ 179

  Fly   194 QAPVPILNKELCQVIYK------------LPASQMCAGFLQGGIDACQGDSGGPLICD----GRL 242
            |..|.|::..||:.:|:            :....:|||  ..|.|:|.|||||||:|:    ..|
  Rat   180 QVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDMLCAG--SHGRDSCYGDSGGPLVCNVTGSWTL 242

  Fly   243 AGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            .|::|||.|||....||||..|..||.||
  Rat   243 VGVVSWGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/263 (32%)
Tryp_SPc 38..273 CDD:238113 86/264 (33%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.