DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss30

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:301 Identity:102/301 - (33%)
Similarity:147/301 - (48%) Gaps:56/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYA--INTSVPLVYR 99
            |||||......:.|:|||:|.    |:.   ||:|||::|.:..|.:||||:.  :|:|      
  Rat    30 KIVGGQDAPEGRWPWQVSLRT----EKE---GHICGGSLIHEVWVLTAAHCFCRPLNSS------ 81

  Fly   100 DPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDY---NGSTLENDIALLFL------NGFIPWE 155
               .|.|..|...:..|:..:....|:.|..:..|   :.|:  .|||||.|      :.|.|..
  Rat    82 ---FYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASS--GDIALLRLDTPLQPSQFSPVC 141

  Fly   156 SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK---------- 210
            .|..:| ||.     .||.|.:.|||....:|.::.||:..||:|:.|.|:.:|.          
  Rat   142 LPQAQA-PLT-----PGTVCWVTGWGATHERELASVLQELAVPLLDSEDCERMYHIGETSLSGKR 200

  Fly   211 -LPASQMCAGFLQGGIDACQGDSGGPLIC----DGRLAGIISWGVGCADPGYPGVYTNVSHFLKW 270
             :.:..:||||::|..|:|||||||||:|    .....||.|||:|||.|..|||||.|..::.|
  Rat   201 VIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDW 265

  Fly   271 IRRANASLDYSEYRQIPPLNLASRRSVSSSCLGIGVLALAM 311
            |:|..|......|      ...||.|.:...|.:.:||.|:
  Rat   266 IQRTLAENHSDAY------GCRSRASGAYPALLLVLLAFAL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 90/259 (35%)
Tryp_SPc 38..273 CDD:238113 91/260 (35%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.