DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss3b

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:260 Identity:97/260 - (37%)
Similarity:136/260 - (52%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VILP------KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAIN 91
            |.||      |||||||...:.:|:|||:....         |.|||::|:.:.|.||||||...
  Rat    14 VALPLDDDDDKIVGGYTCQKNSLPYQVSLNAGY---------HFCGGSLINSQWVVSAAHCYKSR 69

  Fly    92 TSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWES 156
            ..|.|  .:..:.||..|...||          ..:|:.|..||.:|.:|||.|:.||      |
  Rat    70 IQVRL--GEHNIDVVEGGEQFID----------AAKIIRHPSYNANTFDNDIMLIKLN------S 116

  Fly   157 PG-----VRAIPLAIKAPEEGTTCLIHGWGKVTMKEKS--ASLQQAPVPILNKELCQVIY--KLP 212
            |.     |..:.|.......||.||:.|||.......:  :.||....|:|:...|:..|  |:.
  Rat   117 PATLNSRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYPGKIT 181

  Fly   213 ASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            ::..|.|||:||.|:||||||||::|:|:|.|::|||.|||..|.|||||.|.:::.||::..|:
  Rat   182 SNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQTVAA 246

  Fly   278  277
              Rat   247  246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 91/242 (38%)
Tryp_SPc 38..273 CDD:238113 92/243 (38%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 91/242 (38%)
Tryp_SPc 25..243 CDD:238113 92/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.