DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and TMPRSS12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:256 Identity:83/256 - (32%)
Similarity:127/256 - (49%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYG--LGHVCGGAVISQRVVCSAAHCYAINTSVPLVYR 99
            :|:||........|:.||::.:      ||  |.|||||.::.:|.|.:||||....:       
Human    77 RIIGGTEAQAGAWPWVVSLQIK------YGRVLVHVCGGTLVRERWVLTAAHCTKDAS------- 128

  Fly   100 DPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFL------NGFIPWESPG 158
            ||.::..|.|::.|......|::..::.|:.|.::...:..|||||..|      |.:|   .| 
Human   129 DPLMWTAVIGTNNIHGRYPHTKKIKIKAIIIHPNFILESYVNDIALFHLKKAVRYNDYI---QP- 189

  Fly   159 VRAIPLAIKAPEEGTT-CLIHGWGKVTMKEKSAS--LQQAPVPILNKELCQVIYK----LPASQM 216
             ..:|..:....:|.| |.|.|||: |.:|.:|:  ||.|.|..:::|:|.....    :|.:..
Human   190 -ICLPFDVFQILDGNTKCFISGWGR-TKEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSF 252

  Fly   217 CAGFLQGGIDACQGDSGGPLIC------DGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            |||...|..|.|:|||||||:|      ...:.||.|:|.||...|:||||...|.:.||:
Human   253 CAGDEDGAFDTCRGDSGGPLMCYLPEYKRFFVMGITSYGHGCGRRGFPGVYIGPSFYQKWL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 82/254 (32%)
Tryp_SPc 38..273 CDD:238113 83/255 (33%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63
Tryp_SPc 78..316 CDD:238113 83/255 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.