DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Tmprss5

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:248 Identity:91/248 - (36%)
Similarity:129/248 - (52%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAINTSVPLVYRD 100
            :||||..|...:.|:|.||.        .|..|.||.:|::...|.:|||| |:...|....:| 
  Rat   207 RIVGGQAVASGRWPWQASVM--------LGSRHTCGASVLAPYWVVTAAHCMYSFRLSRLSSWR- 262

  Fly   101 PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLA 165
              ::..:...||:    |..|..:|::|:.|..|:....:.|:|||.|...|.: |..|.|:.|.
  Rat   263 --VHAGLVSHSAV----RQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINF-SDTVSAVCLP 320

  Fly   166 IKAPE--EGTTCLIHGWGKV--TMKEKSASLQQAPVPILNKELC--QVIYK--LPASQMCAGFLQ 222
            .|...  :|:.|.:.|||..  :....|.:||...||:|:.:||  ..:|.  |....:|||:|.
  Rat   321 AKEQHFPQGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTDLCNSSCMYSGALTHRMLCAGYLD 385

  Fly   223 GGIDACQGDSGGPLICDG----RLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            |..|||||||||||:|..    .|.|::|||.|||:|..||||..|:.||.||
  Rat   386 GRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 89/246 (36%)
Tryp_SPc 38..273 CDD:238113 91/247 (37%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055
Tryp_SPc 208..441 CDD:238113 91/247 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24253
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.