DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and KLK13

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:291 Identity:93/291 - (31%)
Similarity:141/291 - (48%) Gaps:54/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVAT-----HSGITQ--SQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVS--VRRRS 59
            :|...|::|:     ..|::|  |::.....|:.   .||   ||||......|:|.:  |:.|.
Human     1 MWPLALVIASLTLALSGGVSQESSKVLNTNGTSG---FLP---GGYTCFPHSQPWQAALLVQGRL 59

  Fly    60 IHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYL 124
            :          |||.::..:.|.:||||......|.|            |..|:.|.:...|...
Human    60 L----------CGGVLVHPKWVLTAAHCLKEGLKVYL------------GKHALGRVEAGEQVRE 102

  Fly   125 VQRIVGHKDYNGSTL----ENDIALLFLNGFIPWESPG-VRAIPLAIK---APEEGTTCLIHGWG 181
            |...:.|.:|..|..    ::||.||.|..  |.:..| ::.:||:..   .|  ||||.:.|||
Human   103 VVHSIPHPEYRRSPTHLNHDHDIMLLELQS--PVQLTGYIQTLPLSHNNRLTP--GTTCRVSGWG 163

  Fly   182 KVTMKEKS--ASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRL 242
            ..|..:.:  .:||.|.:.:.:.|.|:.:|  |:..:.:|||..:||.|:|:|||||||:|:..|
Human   164 TTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTL 228

  Fly   243 AGIISWG-VGCADPGYPGVYTNVSHFLKWIR 272
            .||:||| ..|..|..|||||.||.::.|||
Human   229 YGIVSWGDFPCGQPDRPGVYTRVSRYVLWIR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 81/248 (33%)
Tryp_SPc 38..273 CDD:238113 84/250 (34%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 84/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.