DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klkb1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:250 Identity:85/250 - (34%)
Similarity:135/250 - (54%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||...::.:.|:|||::.:.:.:     .|:|||::|.::.:.:||||:   ..:|.    |
  Rat   390 RIVGGTNSSLGEWPWQVSLQVKLVSQ-----NHMCGGSIIGRQWILTAAHCF---DGIPY----P 442

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLN---GFIPWESPGVRAIP 163
            :::.:..|...:......|....::.::.|:.|..|....||||:.|.   .:..::.|    |.
  Rat   443 DVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKP----IC 503

  Fly   164 LAIKAPEEG--TTCLIHGWGKVTMKEKSAS---LQQAPVPILNKELCQVIYK---LPASQMCAGF 220
            |..||....  |.|.:.|||..  ||:..:   ||:|.:|::..|.||..|:   :....:|||:
  Rat   504 LPSKADTNTIYTNCWVTGWGYT--KERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGY 566

  Fly   221 LQGGIDACQGDSGGPLIC--DGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            .:||||||:|||||||:|  .||  |.||.|||.|||....|||||.|:.::.||
  Rat   567 KEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/248 (33%)
Tryp_SPc 38..273 CDD:238113 84/248 (34%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 83/248 (33%)
Tryp_SPc 391..621 CDD:238113 83/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.