DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:275 Identity:105/275 - (38%)
Similarity:141/275 - (51%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCG 72
            |||:|.        :|  .|.|.|.....|||||||.....||:|||:....         |.||
  Rat     4 LLILAL--------VG--AAVAFPLEDDDKIVGGYTCPEHSVPYQVSLNSGY---------HFCG 49

  Fly    73 GAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGS 137
            |::|:.:.|.||||||.....|.|            |...|:..:...|.....:|:.|.:|:..
  Rat    50 GSLINDQWVVSAAHCYKSRIQVRL------------GEHNINVLEGDEQFINAAKIIKHPNYSSW 102

  Fly   138 TLENDIALLFLNGFIPWESP---GVRAIPLAIK---APEEGTTCLIHGWGKVTMK--EKSASLQQ 194
            ||.|||.|:.|:      ||   ..|..|:|:.   || .||.|||.|||.....  .....||.
  Rat   103 TLNNDIMLIKLS------SPVKLNARVAPVALPSACAP-AGTQCLISGWGNTLSNGVNNPDLLQC 160

  Fly   195 APVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGY 257
            ...|:|::..|:..|  ::.:|.:|.|||:||.|:||||||||::|:|:|.||:|||.|||.|..
  Rat   161 VDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDN 225

  Fly   258 PGVYTNVSHFLKWIR 272
            |||||.|.:|:.||:
  Rat   226 PGVYTKVCNFVGWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 95/243 (39%)
Tryp_SPc 38..273 CDD:238113 96/245 (39%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 95/243 (39%)
Tryp_SPc 24..242 CDD:238113 96/245 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.