DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG30031

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:253 Identity:87/253 - (34%)
Similarity:130/253 - (51%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFVILP----KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAI 90
            |..:||    :||||...||...|:|:|::|..        .|.|||::.|..|:.:|||| .::
  Fly    20 PEGLLPQLDGRIVGGSATTISSFPWQISLQRSG--------SHSCGGSIYSSNVIVTAAHCLQSV 76

  Fly    91 NTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE 155
            :.|| |..|....|....|.:           :.|.....|:.||.:|:.||||::.:||.:.:.
  Fly    77 SASV-LQIRAGSSYWSSGGVT-----------FSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129

  Fly   156 SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKS--ASLQQAPVPILNKELC-QVIY----KLPA 213
            |. ::||.||...|..|....:.|||.::....|  :.||...|.|:::..| ...|    ::.:
  Fly   130 ST-IKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRS 193

  Fly   214 SQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            :.:||.  ..|.|||||||||||:..|.|.|::|||.|||...|||||.:|:....|:
  Fly   194 TMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/241 (34%)
Tryp_SPc 38..273 CDD:238113 84/242 (35%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.