DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk1b3

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:286 Identity:95/286 - (33%)
Similarity:138/286 - (48%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            :|..:|.:|...|...:        |.|  :..::||||...::..|:||:|        :|...
  Rat     5 MWFLILFLALSLGRNDA--------APP--VQSRVVGGYNCEMNSQPWQVAV--------YYFGE 51

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            ::|||.:|....|.:||||...|            |.|..|.:.:...:.|.|..||.:...|..
  Rat    52 YLCGGVLIDPSWVITAAHCATDN------------YQVWLGRNNLYEDEPFAQHRLVSQSFPHPG 104

  Fly   134 YN-----------GSTLENDIALLFLNGFIPWE-SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMK 186
            :|           |....||:.||.|:.  |.: :.||:.|.|.|:.|:.|:|||..|||.:|..
  Rat   105 FNQDLIWNHTRQPGDDYSNDLMLLHLSQ--PADITDGVKVIDLPIEEPKVGSTCLASGWGSITPD 167

  Fly   187 --EKSASLQQAPVPILNKELCQVIYKLPAS--QMCAGFLQGGIDACQGDSGGPLICDGRLAGIIS 247
              |.|..||...:.:|:.|.|...:|...:  .:|||.:.||.|.|:|||||||||:|.|.||.|
  Rat   168 GLELSDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICNGVLQGITS 232

  Fly   248 WGVG-CADPGYPGVYTNVSHFLKWIR 272
            ||.. |.:|..||:||.:..|..||:
  Rat   233 WGFNPCGEPKKPGIYTKLIKFTPWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 87/250 (35%)
Tryp_SPc 38..273 CDD:238113 89/252 (35%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 87/250 (35%)
Tryp_SPc 29..260 CDD:238113 89/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.