DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Gzmn

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_694692.1 Gene:Gzmn / 245839 MGIID:2675494 Length:248 Species:Mus musculus


Alignment Length:262 Identity:78/262 - (29%)
Similarity:123/262 - (46%) Gaps:55/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ILP------KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINT 92
            :||      :::||:.|.....|:...|    :..:..|:|..|||.::....|.:||||...:.
Mouse    11 LLPVGDGAEEVIGGHEVKPHSRPYMALV----VFLKVNGIGSSCGGFLVQDYFVLTAAHCIGSSM 71

  Fly    93 SVPLVYRDPELYVVVAGSSAIDRTDRFTQEYL-VQRIVGHKDYNGSTLENDIALLFLNGFIPWES 156
            :|.|            |:..: |....||:.: |.:.:.|.|||.....|||.||.|..    ::
Mouse    72 TVTL------------GAHNL-RAQEETQQIIPVNKALPHPDYNPLDHTNDIMLLKLES----KA 119

  Fly   157 PGVRAI-PLAIKAPEE----GTTCLIHGWGKVTMK--EKSASLQQAPVPILNKELC--QVIYKLP 212
            .|.|.: ||.:..|::    |..|.:.||||.::.  |.||.|::|.:.|...:.|  |..:...
Mouse   120 KGTRDVRPLKLPGPKDKVNPGDVCSVAGWGKTSINTTEGSALLEEAELIIQENKECKKQFRHYSK 184

  Fly   213 ASQMCAGFLQGGIDA-CQGDSGGPLICDGRLAGIISWGVGCADPGY-------PGVYTNVSHFLK 269
            .:::|||. ...|:| .:|||||||:|:.:..|::|         |       .||:|.|.|||.
Mouse   185 ITEICAGD-PNKIEAPSKGDSGGPLVCNNKAHGVLS---------YVKSKKISSGVFTKVVHFLP 239

  Fly   270 WI 271
            ||
Mouse   240 WI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/251 (29%)
Tryp_SPc 38..273 CDD:238113 76/252 (30%)
GzmnNP_694692.1 Tryp_SPc 20..241 CDD:214473 74/251 (29%)
Tryp_SPc 21..244 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.