DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Cela2a

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:291 Identity:81/291 - (27%)
Similarity:133/291 - (45%) Gaps:58/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCG 72
            ||:.|..:|..  ..|.||......|  .::|||...:.:..|:|||::..|..:.|    |.||
  Rat     5 LLLSALVAGAL--SCGYPTYEVQHDV--SRVVGGQEASPNSWPWQVSLQYLSSGKWH----HTCG 61

  Fly    73 GAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGS 137
            |::::...|.:||||.:          :...|.|:.|..::..::..:....|.::|.|:.:|..
  Rat    62 GSLVANNWVLTAAHCIS----------NSRTYRVLLGRHSLSTSESGSLAVQVSKLVVHEKWNAQ 116

  Fly   138 TLE--NDIALLFLNGFIPWESPGVRAIPLAIKA-------PEEGT------TCLIHGWGKVTMKE 187
            .|.  |||||:.|            |.|:|:.:       |..||      .|.:.|||::....
  Rat   117 KLSNGNDIALVKL------------ASPVALTSKIQTACLPPAGTILPNNYPCYVTGWGRLQTNG 169

  Fly   188 KSAS-LQQAPVPILNKELCQVI----YKLPASQMCAGFLQGGIDACQGDSGGPLICDG-----RL 242
            .:.. |||..:.:::...|...    ..:..:.:|||. .|...:|.|||||||.|..     ::
  Rat   170 ATPDVLQQGRLLVVDYATCSSASWWGSSVKTNMVCAGG-DGVTSSCNGDSGGPLNCQASNGQWQV 233

  Fly   243 AGIISWG--VGCADPGYPGVYTNVSHFLKWI 271
            .||:|:|  :||..|..|.|:|.||:::.||
  Rat   234 HGIVSFGSTLGCNYPRKPSVFTRVSNYIDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/260 (27%)
Tryp_SPc 38..273 CDD:238113 73/261 (28%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 71/260 (27%)
Tryp_SPc 31..267 CDD:238113 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.