DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:278 Identity:90/278 - (32%)
Similarity:142/278 - (51%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTID-QVPFQVSVRRRSIHERHYGLGHVCGG 73
            ::.:..||..|....|...:|.   ..:||.|....:: :.|:|.|::.       .|.||.||.
Mouse   182 LLNSRCGIRMSSSNIPLPASSS---TERIVQGRETAMEGEWPWQASLQL-------IGAGHQCGA 236

  Fly    74 AVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVG----HKDY 134
            .:||...:.:||||:..|       |||..::|..|::....        ||:|.||    |::|
Mouse   237 TLISNTWLLTAAHCFWKN-------RDPTKWIVTFGTTITPP--------LVKRSVGKIIIHEEY 286

  Fly   135 NGSTLENDIALLFLNGFIPWESPGVR-AIP-LAIKAPEEGTTCLIHGWGKVTMKEKSAS-LQQAP 196
            :..|.||||||..|...:.:.:...| .:| .::|.|.: |:..:.|:|.:.....:.: |:||.
Mouse   287 HRDTNENDIALAQLTTRVEFSNVVQRVCLPDSSMKLPPK-TSVFVTGFGSIVDDGPTQNKLRQAR 350

  Fly   197 VPILNKELC--QVIYK--LPASQMCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCA 253
            |..:..::|  :.:|.  :....:||||::|.||||:|||||||:.|.|    :.||:|||..||
Mouse   351 VETIGSDVCNRKDVYDGLITPGMLCAGFMEGKIDACKGDSGGPLVYDNRDIWYIVGIVSWGQSCA 415

  Fly   254 DPGYPGVYTNVSHFLKWI 271
            .|..|||||.|:.:..||
Mouse   416 LPNKPGVYTRVTKYRDWI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/249 (33%)
Tryp_SPc 38..273 CDD:238113 85/250 (34%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113
Tryp_SPc 207..436 CDD:238113 85/250 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.