DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and TPSD1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:242 Identity:68/242 - (28%)
Similarity:98/242 - (40%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ASPFVILPK---------IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSA 84
            |||..:.|.         ||||......:.|:|||:|.|..:..|:     |||::|..:.|.:|
Human    20 ASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHF-----CGGSLIHPQWVLTA 79

  Fly    85 AHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYL--VQRIVGHKDYNGSTLENDIALLF 147
            |||.           :|::..:.|....:.....:.|:.|  |.||:.|..:.......|||||.
Human    80 AHCV-----------EPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLE 133

  Fly   148 LNGFIPWESP-------GVRAIPLAIKAPEEGTTCLIHGWGKVTMK---EKSASLQQAPVPILNK 202
            |      |.|       ....:|.|.:....|..|.:.|||.|...   .....|::..||::..
Human   134 L------EEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVEN 192

  Fly   203 ELCQVIYK-----------LPASQMCAGFLQGGIDACQGDSGGPLIC 238
            .||...|.           :....:|||  ....|:|||||||||:|
Human   193 HLCNAEYHTGLHTGHSFQIVRDDMLCAG--SENHDSCQGDSGGPLVC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 64/234 (27%)
Tryp_SPc 38..273 CDD:238113 64/224 (29%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 64/224 (29%)
Tryp_SPc 38..240 CDD:214473 64/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.