DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and F12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_000496.2 Gene:F12 / 2161 HGNCID:3530 Length:615 Species:Homo sapiens


Alignment Length:266 Identity:93/266 - (34%)
Similarity:131/266 - (49%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGL--GH-VCGGAVISQRVVCSAAHCYAINTSVPL 96
            :.::|||.            |..|..|.....|  || .|.|::|:...|.:||||.....:   
Human   370 MTRVVGGL------------VALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPA--- 419

  Fly    97 VYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFL----NGFIPWESP 157
                ||...||.|....:.:....|...|:....|:.::..:.::|:|||.|    :|.....||
Human   420 ----PEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP 480

  Fly   158 GVR--AIPLAIKAPEEGTTCLIHGWGK--VTMKEKSASLQQAPVPILNKELCQV--IYK---LPA 213
            .|:  .:|.....|.|.|.|.:.|||.  ...:|.::.||:|.||.|:.|.|..  ::.   || 
Human   481 YVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILP- 544

  Fly   214 SQMCAGFLQGGIDACQGDSGGPLICDGR-------LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ..:|||||:||.|||||||||||:|:.:       |.||||||.||.|...|||||:|:::|.||
Human   545 GMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWI 609

  Fly   272 RRANAS 277
            |....|
Human   610 REHTVS 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 89/256 (35%)
Tryp_SPc 38..273 CDD:238113 91/257 (35%)
F12NP_000496.2 FN2 41..88 CDD:128373
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
Kringle 217..295 CDD:278480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359
Tryp_SPc 372..609 CDD:214473 89/256 (35%)
Tryp_SPc 373..612 CDD:238113 92/258 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.