DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and F11

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:253 Identity:92/253 - (36%)
Similarity:132/253 - (52%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAINTSVPLV 97
            |.|:||||......:.|:||::...|..:|     |:|||::|..:.:.:|||| |.:.:  |.:
Human   385 IKPRIVGGTASVRGEWPWQVTLHTTSPTQR-----HLCGGSIIGNQWILTAAHCFYGVES--PKI 442

  Fly    98 YRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAI 162
            .|   :|..:...|.|.....|   :.||.|:.|..|..:....|||||.|...:.: :...|.|
Human   443 LR---VYSGILNQSEIKEDTSF---FGVQEIIIHDQYKMAESGYDIALLKLETTVNY-TDSQRPI 500

  Fly   163 PLAIKAPEEG------TTCLIHGWGKVTMKEK-SASLQQAPVPILNKELCQVIY---KLPASQMC 217
            .|    |.:|      |.|.:.|||...:::| ..:||:|.:|::..|.||..|   |:....:|
Human   501 CL----PSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMIC 561

  Fly   218 AGFLQGGIDACQGDSGGPLICD----GRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ||:.:||.|||:|||||||.|.    ..|.||.|||.|||....|||||||..::.||
Human   562 AGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWI 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/248 (35%)
Tryp_SPc 38..273 CDD:238113 90/249 (36%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519
Tryp_SPc 388..619 CDD:214473 88/248 (35%)
Tryp_SPc 389..619 CDD:238113 88/247 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.