DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Tmprss13

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_006510195.1 Gene:Tmprss13 / 214531 MGIID:2682935 Length:561 Species:Mus musculus


Alignment Length:260 Identity:87/260 - (33%)
Similarity:130/260 - (50%) Gaps:51/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||...:..:.|:|||:        |:|..|:|||.:|..:.|.:||||:.:.....|     
Mouse   319 RIVGGALTSESKWPWQVSL--------HFGTTHICGGTLIDAQWVLTAAHCFFVTREKLL----- 370

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI 166
            |.:.|.||:|.:   .:..:...:.:|:.:.:|.....:.||||:.|:.            ||.:
Mouse   371 EGWKVYAGTSNL---HQLPEAASISQIIINGNYTDEQDDYDIALIRLSK------------PLTL 420

  Fly   167 KA-------PEEG------TTCLIHGWGKV--TMKEKSASLQQAPVPILNKELCQ--VIYK--LP 212
            .|       |..|      .||.|.|:||.  |.::.|..|::..|.:::.:.|.  ::|.  |.
Mouse   421 SAHIHPACLPMHGQTFGLNETCWITGFGKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLT 485

  Fly   213 ASQMCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            ...||||.|:||.|:|||||||||:|:..    |||:.|||.||.....|||||.|:..|.||.|
Mouse   486 PRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWIYR 550

  Fly   274  273
            Mouse   551  550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/256 (33%)
Tryp_SPc 38..273 CDD:238113 86/257 (33%)
Tmprss13XP_006510195.1 PHA03378 <6..>122 CDD:223065
LDLa <204..220 CDD:238060
SRCR_2 225..314 CDD:373897
Tryp_SPc 319..548 CDD:214473 84/256 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.