DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and ELANE

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001963.1 Gene:ELANE / 1991 HGNCID:3309 Length:267 Species:Homo sapiens


Alignment Length:258 Identity:89/258 - (34%)
Similarity:118/258 - (45%) Gaps:51/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAI 90
            ||.||      :||||........||.||::.|.        ||.||..:|:...|.|||||.| 
Human    24 TALAS------EIVGGRRARPHAWPFMVSLQLRG--------GHFCGATLIAPNFVMSAAHCVA- 73

  Fly    91 NTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE 155
            |.:|..|.       ||.|:..:.|.:...|.:.||||. ...|:...|.|||.:|.|||     
Human    74 NVNVRAVR-------VVLGAHNLSRREPTRQVFAVQRIF-ENGYDPVNLLNDIVILQLNG----- 125

  Fly   156 SPGVRAIPLAIKAPEE------GTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIYKLPA 213
            |..:.|.....:.|.:      |..||..|||.:......|| ||:..|.::. .||:      .
Human   126 SATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVT-SLCR------R 183

  Fly   214 SQMCA---GFLQGGIDACQGDSGGPLICDGRLAGIISW--GVGCADPGYPGVYTNVSHFLKWI 271
            |.:|.   | .|.|:  |.||||.||:|:|.:.||.|:  | |||...||..:..|:.|:.||
Human   184 SNVCTLVRG-RQAGV--CFGDSGSPLVCNGLIHGIASFVRG-GCASGLYPDAFAPVAQFVNWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/245 (34%)
Tryp_SPc 38..273 CDD:238113 85/246 (35%)
ELANENP_001963.1 Tryp_SPc 30..245 CDD:238113 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.