DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss8

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:348 Identity:118/348 - (33%)
Similarity:165/348 - (47%) Gaps:59/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHLWMCLLIVATHSGITQSQIGQPTATAS-PFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERH 64
            ::.|::.|||     |:.||:||.....|| ..||.|:|.||.:....|.|:|||:....:    
  Rat    12 LEALFILLLI-----GLLQSRIGADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYNGV---- 67

  Fly    65 YGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIV 129
                |||||:::|.:.|.|||||:....|       .|.|.|..|:..:|........:.|.:|:
  Rat    68 ----HVCGGSLVSNQWVVSAAHCFPREHS-------KEEYEVKLGAHQLDSFSNDIVVHTVAQII 121

  Fly   130 GHKDYNGSTLENDIALLFLNGFIPWESPGVRAI--PLAIKAPEEGTTCLIHGWGKVTMK---EKS 189
            .|..|.....:.||||:.|:..:.: |..:|.|  |.|..:...|..|.:.|||.|...   :..
  Rat   122 SHSSYREEGSQGDIALIRLSSPVTF-SRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTP 185

  Fly   190 ASLQQAPVPILNKELCQVIYKLPA----------SQMCAGFLQGGIDACQGDSGGPLIC--DG-- 240
            ..|||..||::::|.|..:|.:.|          ..:|||:::||.|||||||||||.|  ||  
  Rat   186 RPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLW 250

  Fly   241 RLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANASLDYSEYRQI-------------PPLNLA 292
            .||||:|||..|..|..|||||..|.:..||....|.|......|.             |..|||
  Rat   251 YLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVAELQPRAVPQTQESQPDGHLCNHHPVFNLA 315

  Fly   293 SRRSVSSSCLGIGVLALAMSLRL 315
            :.:.:|..     :|.|.:||.|
  Rat   316 AAQKLSRP-----ILFLPLSLTL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 89/252 (35%)
Tryp_SPc 38..273 CDD:238113 91/253 (36%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 89/252 (35%)
Tryp_SPc 45..284 CDD:238113 91/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.