DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and svh-1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:277 Identity:89/277 - (32%)
Similarity:141/277 - (50%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVI 76
            |:..|:...::....|..|.   :.::|||:.......|:..::|.::....|      ||.:::
 Worm   690 ASQCGLRYVEVNARDAAKSR---IARVVGGFETVPGAFPWTAALRNKATKAHH------CGASIL 745

  Fly    77 SQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLEN 141
            .:..:.:||||:..:..|       ..|.||.|....::||...|.:.:|||..:..|. ....:
 Worm   746 DKTHLITAAHCFEEDERV-------SSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYK-DIFSH 802

  Fly   142 DIALLFLNGFIPWESPGVR----AIPLAIKAPE----EGTTCLIHGWGKVTMKEKSASLQQAPVP 198
            |||:|    .||:  ||:.    |.|:.:.:.:    .|..|::.|||.:.:: .:..||.|.:|
 Worm   803 DIAIL----EIPY--PGIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGSMGLR-YAERLQAALIP 860

  Fly   199 ILNKELC----QVIYKLPASQMCAGFLQGGIDACQGDSGGPLIC---DGR--LAGIISWGVGCAD 254
            |:|:..|    |:...:..|..|||:|:||||:||||||||..|   ||.  |||:||||.|||.
 Worm   861 IINRFDCVNSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQ 925

  Fly   255 PGYPGVYTNVSHFLKWI 271
            ...||:||.|:.:|.||
 Worm   926 KKQPGIYTMVAPYLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/250 (33%)
Tryp_SPc 38..273 CDD:238113 85/251 (34%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 85/251 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.