DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Tpsb2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:266 Identity:86/266 - (32%)
Similarity:130/266 - (48%) Gaps:57/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPE 102
            ||||:..:..:.|:|||:|    .:.:|.: |.|||::|..:.|.:||||..     |.: :.|:
Mouse    32 IVGGHEASESKWPWQVSLR----FKLNYWI-HFCGGSLIHPQWVLTAAHCVG-----PHI-KSPQ 85

  Fly   103 LYVVVAGSSAIDRTDRFTQEYL--------VQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGV 159
            |:.|           :..::||        :.|||.|..|..:....|:|||.|.  :| .:...
Mouse    86 LFRV-----------QLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELE--VP-VNVST 136

  Fly   160 RAIPLAIKAPEE----GTTCLIHGWGKVTMKE---KSASLQQAPVPILNKELCQVIYK------- 210
            ...|:::....|    ||:|.:.|||.:...|   ....|:|..|||:...||...|.       
Mouse   137 HLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGD 201

  Fly   211 ----LPASQMCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHF 267
                :....:|||..:.  |:|||||||||:|..:    .||::|||.|||.|..||:||.|:::
Mouse   202 DFPIVHDGMLCAGNTRR--DSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYY 264

  Fly   268 LKWIRR 273
            |.||.|
Mouse   265 LDWIHR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/262 (32%)
Tryp_SPc 38..273 CDD:238113 85/264 (32%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 85/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.