DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk1b1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:290 Identity:90/290 - (31%)
Similarity:129/290 - (44%) Gaps:57/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            :|..:|.:|...|         ...|:| .:..:||||:....:..|:.|:|.|..        .
Mouse     1 MWFLILFLALSLG---------GIDAAP-PVQSRIVGGFKCEKNSQPWHVAVYRYK--------E 47

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            ::|||.::....|.:|||||....:|.|            |.:.:.:.:...|..||.:...|..
Mouse    48 YICGGVLLDANWVLTAAHCYYEKNNVWL------------GKNNLYQDEPSAQHRLVSKSFLHPC 100

  Fly   134 YNGSTLEN-----------DIALLFLNGFIPWESPG-----VRAIPLAIKAPEEGTTCLIHGWGK 182
            ||.|...|           |:.||.|:      .|.     |:.|.|..:.|:.|:|||..|||.
Mouse   101 YNMSLHRNRIQNPQDDYSYDLMLLRLS------KPADITDVVKPIALPTEEPKLGSTCLASGWGS 159

  Fly   183 V--TMKEKSASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLA 243
            :  ...:.:..||...:.:|..|.|...|  |:....:|||...||.|.|:|||||||||||.|.
Mouse   160 IIPVKFQYAKDLQCVNLKLLPNEDCDKAYVQKVTDVMLCAGVKGGGKDTCKGDSGGPLICDGVLQ 224

  Fly   244 GIISWGVG-CADPGYPGVYTNVSHFLKWIR 272
            |:.|||.. |.:|..|||||.:..|..||:
Mouse   225 GLTSWGYNPCGEPKKPGVYTKLIKFTSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 82/254 (32%)
Tryp_SPc 38..273 CDD:238113 84/256 (33%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 82/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.