DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk1b24

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:283 Identity:92/283 - (32%)
Similarity:135/283 - (47%) Gaps:41/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            :|..:|.:|...|         ...|:| .:..::|||:....:..|:.|:|.|.:        .
Mouse     1 MWFLILFLALSLG---------GIDAAP-PVQSRVVGGFKCEKNSQPWHVAVFRYN--------K 47

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            ::|||.:::...|.:|||||...||         .|.|..|.:.:.:.:...|...|.:...|.|
Mouse    48 YICGGVLLNPNWVLTAAHCYGNATS---------QYNVWLGKNKLFQREPSAQHRWVSKSFPHPD 103

  Fly   134 YNGSTLENDIA--------LLFLNGFIPWE-SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMK--E 187
            ||.|.|.:||.        |:.|....|.: :..|:.|.|..:.|:.|:|||..|||.:|..  :
Mouse   104 YNMSLLNDDIPQPKDKSNDLMLLRLSEPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKWQ 168

  Fly   188 KSASLQQAPVPILNKELC--QVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWG- 249
            |...||...:.:|..|.|  ..::|:....:|||.:.||.|.|.|||||||||||.|.||.||| 
Mouse   169 KPNDLQCVFIKLLPNENCTKPYLHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGILHGITSWGP 233

  Fly   250 VGCADPGYPGVYTNVSHFLKWIR 272
            |.|..|..|.:||.:..|..||:
Mouse   234 VPCGKPNAPAIYTKLIKFASWIK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/247 (34%)
Tryp_SPc 38..273 CDD:238113 86/249 (35%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 84/247 (34%)
Tryp_SPc 25..258 CDD:238113 86/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.