DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and PRSS36

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:273 Identity:90/273 - (32%)
Similarity:126/273 - (46%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC 87
            |:|..:|       :||||........|:|||:        |:|.||:|||::|:...|.|||||
Human    39 GRPEPSA-------RIVGGSNAQPGTWPWQVSL--------HHGGGHICGGSLIAPSWVLSAAHC 88

  Fly    88 YAINTSVPLVYRDPEL-YVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLN-- 149
            :..|.::     :|.. :.|:.|..:.|..........|..||...:|:...|..|:|||.|.  
Human    89 FMTNGTL-----EPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASP 148

  Fly   150 ---GFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSA---SLQQAPVPILNKELCQVI 208
               |...|..    .:|.|......||.|...|||.|...:...   .||:..:.:|.:..||.:
Human   149 ASLGPAVWPV----CLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCL 209

  Fly   209 YKLPA----------SQMCAGFLQGGIDACQGDSGGPLICD--GR--LAGIISWGVGCADPGYPG 259
            |..|.          ..:|||:.:|..|.|||||||||:|:  ||  .|||.|:|.||.....||
Human   210 YSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPG 274

  Fly   260 VYTNVSHFLKWIR 272
            |:|.|:.:..|||
Human   275 VFTAVATYEAWIR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/256 (33%)
Tryp_SPc 38..273 CDD:238113 87/258 (34%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 84/256 (33%)
Tryp_SPc 47..289 CDD:238113 87/258 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.