DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG43742

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:285 Identity:83/285 - (29%)
Similarity:125/285 - (43%) Gaps:53/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH 69
            |..||:||.  .|.|:...|.........|..::..|:|....|  |..::...|        ..
  Fly     4 WFSLLLVAV--VIYQNAFAQLLDENCKVKITYRVANGHTAITSQ--FMAALYNNS--------EF 56

  Fly    70 VCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAG----SSAIDRTDRFTQEYLVQRIVG 130
            .|||::|.::.|.:||||          .||.:...|..|    |..|.......:  |..:::.
  Fly    57 FCGGSLIHKQYVLTAAHC----------VRDLDEVTVHLGENNRSCPIPVCKHVLR--LNAKVIL 109

  Fly   131 HKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTT-----CLIHGWGKVTMKEKSA 190
            |.:::|:...||||||.|...:.:|: .:|  |:.|...|:.|:     ...:||||......|.
  Fly   110 HPNFHGNIFLNDIALLRLEREVIFEA-HIR--PICIILDEDVTSNNQNNFTAYGWGKTEHGNISD 171

  Fly   191 SLQQAPVPILNKELCQVIYKLPASQMCAGFLQGGIDACQGDSGGPLICD----GR----LAGIIS 247
            .|....:..|.|.:|   |: ..:.:|||...|  |.|:.|||||||.:    |:    |.||.|
  Fly   172 VLSFIDLVRLPKSMC---YQ-NINTICAGSTSG--DTCESDSGGPLIGNFVHRGKSRDILFGITS 230

  Fly   248 WG-VGCADPGYPGVYTNVSHFLKWI 271
            :| ..|:  |..||||:|:.:..||
  Fly   231 YGDAECS--GLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 72/251 (29%)
Tryp_SPc 38..273 CDD:238113 74/252 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 72/251 (29%)
Tryp_SPc 35..256 CDD:238113 74/252 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.